PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30174.m008803
Common NameLOC8265831, RCOM_1609500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 302aa    MW: 33943.3 Da    PI: 8.7324
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30174.m008803genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.55.8e-41150227178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cq+egC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+++
  30174.m008803 150 RCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSHQ 227
                    6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-35144212IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.376148225IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.09E-37149226IPR004333Transcription factor, SBP-box
PfamPF031108.0E-31151224IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MLEYEWGNPS TIMLTGEEQS QDPDQNRQIF DHYTAQSFND NLLAQPAASL FHHPNPHQVN  60
SLYDPRASSY TAPHHPSLLS LDPIPTHTAP CPSYFLVPKT EQVTRPQDYT SRIGLNLGGR  120
TYFSSAEDDF VNRLYRRSRP VEPGSSNAPR CQAEGCNADL THAKHYHRRH KVCEFHSKAS  180
TVIAAGLTQR FCQQCSRFHL LSEFDNGKRS CRKRLADHNR RRRKSHQINH DANKSHPETA  240
TNSSSENLPR SPQDSGTHNS SSSVTVAVSP PRMFLDCFRQ RPYQATASSS SASSSSLFFS  300
SG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-32143224384squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511636.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL32e-88SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLB9RD470.0B9RD47_RICCO; LIGULELESS1 protein, putative
STRINGPOPTR_0014s05680.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.18e-89squamosa promoter binding protein-like 8